Crystal structure of the placozoa trichoplax adhaerens smad4-mh1 bound to the ggcgc site.
PDB DOI: 10.2210/pdb5nm9/pdb
Classification: TRANSCRIPTION Organism(s): Hepacivirus C , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2017-04-05 Deposition Author(s): Freier, R. , Kaczmarska, Z. , Macias, M.J. , Marquez, J.A.
Crystal structure of the placozoa trichoplax adhaerens smad4-mh1 bound to the ggcgc site.
Freier, R. , Kaczmarska, Z. , Macias, M.J. , Marquez, J.A.
Primary Citation of Related Structures: 5NM9
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Mothers against decapentaplegic homolog | A | 143 | Hepacivirus C , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GPGMSASGSGDATLGIVHTLMCHRQGGESENFAKRAVESLVKKLKDKRDELDALITAVTSNGIQQSKCVTIARTLDGRLQVAGKKGFPHVIYSRIWRWPDLHKNELKHIKLCKFAFDLKLDHVCVNPYHYERVISPGYNVTDI |
Mothers against decapentaplegic homolog | B | 143 | Hepacivirus C , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GPGMSASGSGDATLGIVHTLMCHRQGGESENFAKRAVESLVKKLKDKRDELDALITAVTSNGIQQSKCVTIARTLDGRLQVAGKKGFPHVIYSRIWRWPDLHKNELKHIKLCKFAFDLKLDHVCVNPYHYERVISPGYNVTDI |
Method: X-RAY DIFFRACTION
Deposited Date: 2017-04-05 Deposition Author(s): Freier, R. , Kaczmarska, Z. , Macias, M.J. , Marquez, J.A.