5N85
Structure of rpa70n in complex with primpol (fragment 514-525)
PDB DOI: 10.2210/pdb5n85/pdb
Classification: PROTEIN BINDING Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2017-02-23 Deposition Author(s): Brissett, N.C. , Doherty, A.J.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 2 Å
Structure of rpa70n in complex with primpol (fragment 514-525)
Brissett, N.C. , Doherty, A.J.
Primary Citation of Related Structures: 5N85
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Replication protein A 70 kDa DNA-binding subunit | A | 123 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSHMVGQLSRGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNE |
| DNA-directed primase/polymerase protein | B | 15 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | DNGIDDAYFLEATED |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2017-02-23 Deposition Author(s): Brissett, N.C. , Doherty, A.J.