Camp-dependent protein kinase a from cricetulus griseus in complex with fragment like molecule 3-aminobenzamide
PDB DOI: 10.2210/pdb5n3q/pdb
Classification: TRANSFERASE Organism(s): Cricetulus Griseus
Deposited: 2017-02-08 Deposition Author(s): Heine, A. , Klebe, G. , Siefker, C.
Method: X-RAY DIFFRACTION Resolution: 1.31 Å
Camp-dependent protein kinase a from cricetulus griseus in complex with fragment like molecule 3-aminobenzamide
Heine, A. , Klebe, G. , Siefker, C.
Primary Citation of Related Structures: 5N3Q
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| cAMP-dependent protein kinase catalytic subunit alpha | A | 353 | Cricetulus Griseus | GHMGNAAAAKKGSEQESVKEFLAKAKEEFLKKWESPSQNTAQLDHFDRIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFTEF |
Method: X-RAY DIFFRACTION
Deposited Date: 2017-02-08 Deposition Author(s): Heine, A. , Klebe, G. , Siefker, C.