Solution structure of oxidized and amidated human iapp (1-37), the diabetes ii peptide.
PDB DOI: 10.2210/pdb5mgq/pdb
Classification: PROTEIN FIBRIL Organism(s): Homo Sapiens
Deposited: 2016-11-21 Deposition Author(s): Reif, B. , Rodriguez Camargo, D.C. , Tripsianes, K.
Solution structure of oxidized and amidated human iapp (1-37), the diabetes ii peptide.
Reif, B. , Rodriguez Camargo, D.C. , Tripsianes, K.
Primary Citation of Related Structures: 5MGQ
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Islet amyloid polypeptide | A | 38 | Homo Sapiens | KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYX |
Method: SOLUTION NMR
Deposited Date: 2016-11-21 Deposition Author(s): Reif, B. , Rodriguez Camargo, D.C. , Tripsianes, K.