5LWC
Nmr solution structure of bacteriocin bacsp222 from staphylococcus pseudintermedius 222
PDB DOI: 10.2210/pdb5lwc/pdb
Classification: ANTIMICROBIAL PROTEIN Organism(s): Staphylococcus Pseudintermedius
Deposited: 2016-09-15 Deposition Author(s): Ejchart, A.O. , Jaremko, L. , Mak, P. , Nowakowski, M.E. , Wladyka, B.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Nmr solution structure of bacteriocin bacsp222 from staphylococcus pseudintermedius 222
Ejchart, A.O. , Jaremko, L. , Mak, P. , Nowakowski, M.E. , Wladyka, B.
Primary Citation of Related Structures: 5LWC
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Bacteriocin BacSp222 | A | 50 | Staphylococcus Pseudintermedius | MAGLLRFLLSKGRALYNWAKSHVGKVWEWLKSGATYEQIKEWIENALGWR |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2016-09-15 Deposition Author(s): Ejchart, A.O. , Jaremko, L. , Mak, P. , Nowakowski, M.E. , Wladyka, B.