5LSO
Crystal structure of spf45 uhm domain with cyclic peptide inhibitor
PDB DOI: 10.2210/pdb5lso/pdb
Classification: Splicing/Inhibitor Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2016-09-05 Deposition Author(s): Garg, D. , Jagtap, P.K.A. , Sattler, M.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 2.22 Å
Crystal structure of spf45 uhm domain with cyclic peptide inhibitor
Garg, D. , Jagtap, P.K.A. , Sattler, M.
Primary Citation of Related Structures: 5LSO
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Splicing factor 45 | A | 103 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | AMGKCPTKVVLLRNMVGAGEVDEDLEVETKEECEKYGKVGKCVIFEIPGAPDDEAVRIFLEFERVESAIKAVVDLNGRYFGGRVVKACFYNLDKFRVLDLAEQ |
| Splicing factor 45 | B | 103 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | AMGKCPTKVVLLRNMVGAGEVDEDLEVETKEECEKYGKVGKCVIFEIPGAPDDEAVRIFLEFERVESAIKAVVDLNGRYFGGRVVKACFYNLDKFRVLDLAEQ |
| LYS-SER-ARG-TRP-ASP-GLU | C | 6 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | KSRWDE |
| LYS-SER-ARG-TRP-ASP-GLU | D | 6 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | KSRWDE |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2016-09-05 Deposition Author(s): Garg, D. , Jagtap, P.K.A. , Sattler, M.