Trypsin inhibitors for the treatment of pancreatitis - cpd 1
PDB DOI: 10.2210/pdb5lh4/pdb
Classification: HYDROLASE Organism(s): Bos Taurus
Deposited: 2016-07-08 Deposition Author(s): Brandl, T. , D'Arcy, A. , Schiering, N. , Simic, O. , Skaanderup, P. , Woelcke, J.
Trypsin inhibitors for the treatment of pancreatitis - cpd 1
Brandl, T. , D'Arcy, A. , Schiering, N. , Simic, O. , Skaanderup, P. , Woelcke, J.
Primary Citation of Related Structures: 5LH4
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Cationic trypsin | A | 223 | Bos Taurus | IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN |
Method: X-RAY DIFFRACTION
Deposited Date: 2016-07-08 Deposition Author(s): Brandl, T. , D'Arcy, A. , Schiering, N. , Simic, O. , Skaanderup, P. , Woelcke, J.