Cocrystal structure of camp-dependent protein kinase (pka) in complex with a r-methyl-piperazine substituted fasudil-derivative (ligand 02)
PDB DOI: 10.2210/pdb5lct/pdb
Classification: TRANSFERASE Organism(s): Cricetulus Griseus , Synthetic Construct
Deposited: 2016-06-22 Deposition Author(s): Heine, A. , Klebe, G. , Wienen-Schmidt, B.
Cocrystal structure of camp-dependent protein kinase (pka) in complex with a r-methyl-piperazine substituted fasudil-derivative (ligand 02)
Heine, A. , Klebe, G. , Wienen-Schmidt, B.
Primary Citation of Related Structures: 5LCT
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| cAMP-dependent protein kinase catalytic subunit alpha | A | 353 | Cricetulus Griseus , Synthetic Construct | GHMGNAAAAKKGSEQESVKEFLAKAKEEFLKKWESPSQNTAQLDHFDRIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFTEF |
| cAMP-dependent protein kinase inhibitor alpha | B | 20 | Cricetulus Griseus , Synthetic Construct | TTYADFIASGRTGRRNAIHD |
Method: X-RAY DIFFRACTION
Deposited Date: 2016-06-22 Deposition Author(s): Heine, A. , Klebe, G. , Wienen-Schmidt, B.