Nmr structure of the sea anemone peptide tau-anmtx ueq 12-1 with an uncommon fold
PDB DOI: 10.2210/pdb5lah/pdb
Classification: TOXIN Organism(s): Marinobacter Aquaeolei Vt8
Deposited: 2016-06-14 Deposition Author(s): Andreev, Y.A. , Arseniev, A.S. , Kozlov, S.A. , Logashina, Y.A. , Mineev, K.S.
Nmr structure of the sea anemone peptide tau-anmtx ueq 12-1 with an uncommon fold
Andreev, Y.A. , Arseniev, A.S. , Kozlov, S.A. , Logashina, Y.A. , Mineev, K.S.
Primary Citation of Related Structures: 5LAH
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
tau-AnmTx Ueq 12-1 | A | 45 | Marinobacter Aquaeolei Vt8 | CYPGQPGCGHCSRPNYCEGARCESGFHDCGSDHWCDASGDRCCCA |
Method: SOLUTION NMR
Deposited Date: 2016-06-14 Deposition Author(s): Andreev, Y.A. , Arseniev, A.S. , Kozlov, S.A. , Logashina, Y.A. , Mineev, K.S.