Targeting the pex14-pex5 interaction by small molecules provides novel therapeutic routes to treat trypanosomiases.
PDB DOI: 10.2210/pdb5l87/pdb
Classification: MEMBRANE PROTEIN Organism(s): Trypanosoma Brucei Brucei
Deposited: 2016-06-07 Deposition Author(s): Dawidowski, M. , Emmanouilidis, L. , Popowicz, G.M. , Sattler, M.
Targeting the pex14-pex5 interaction by small molecules provides novel therapeutic routes to treat trypanosomiases.
Dawidowski, M. , Emmanouilidis, L. , Popowicz, G.M. , Sattler, M.
Primary Citation of Related Structures: 5L87
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Peroxin 14 | A | 69 | Trypanosoma Brucei Brucei | GAMWHTHSEREKRVSNAVEFLLDSRVRRTPTSSKVHFLKSKGLSAEEICEAFTKVGQPKTLNEIKRILS |
Method: X-RAY DIFFRACTION
Deposited Date: 2016-06-07 Deposition Author(s): Dawidowski, M. , Emmanouilidis, L. , Popowicz, G.M. , Sattler, M.