Crystal structure of the complex between the n-terminal sh3 domain of crkii and a proline-rich ligand
PDB DOI: 10.2210/pdb5l23/pdb
Classification: PROTEIN BINDING Organism(s): Mus Musculus , Synthetic Construct
Deposited: 2016-07-30 Deposition Author(s): Bhatt, V.S. , Cho, J.-H. , Krieger, I. , Sacchettini, J.
Crystal structure of the complex between the n-terminal sh3 domain of crkii and a proline-rich ligand
Bhatt, V.S. , Cho, J.-H. , Krieger, I. , Sacchettini, J.
Primary Citation of Related Structures: 5L23
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Adapter molecule crk | A | 58 | Mus Musculus , Synthetic Construct | AEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKYR |
| C3G derived peptide | B | 17 | Mus Musculus , Synthetic Construct | XDNSPPPALPKKRQSYX |
Method: X-RAY DIFFRACTION
Deposited Date: 2016-07-30 Deposition Author(s): Bhatt, V.S. , Cho, J.-H. , Krieger, I. , Sacchettini, J.