Notch1 transmembrane and associated juxtamembrane segment
PDB DOI: 10.2210/pdb5kzo/pdb
Classification: TRANSCRIPTION Organism(s): Homo Sapiens
Deposited: 2016-07-25 Deposition Author(s): Deatherage, C.L. , Kroncke, B. , Lu, Z.
Notch1 transmembrane and associated juxtamembrane segment
Deatherage, C.L. , Kroncke, B. , Lu, Z.
Primary Citation of Related Structures: 5KZO
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Neurogenic locus notch homolog protein 1 | A | 59 | Homo Sapiens | MGHHHHHHVQSETVEPPPPAQLHFMYVAAAAFVLLFFVGCGVLLSRKRRRQHGQLWFPE |
Method: SOLUTION NMR
Deposited Date: 2016-07-25 Deposition Author(s): Deatherage, C.L. , Kroncke, B. , Lu, Z.