Crystal structure of human beta-defensin 4 (hbd4)
PDB DOI: 10.2210/pdb5ki9/pdb
Classification: ANTIMICROBIAL PROTEIN Organism(s): Salmonella Enterica
Deposited: 2016-06-16 Deposition Author(s): Adam, P. , Jacek, L. , Marzenam, P.
Crystal structure of human beta-defensin 4 (hbd4)
Adam, P. , Jacek, L. , Marzenam, P.
Primary Citation of Related Structures: 5KI9
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Beta-defensin 104 | A | 43 | Salmonella Enterica | EFELDRICGYGTARCRKKCRSQEYRIGRCPNTYACCLRKWDES |
Method: X-RAY DIFFRACTION
Deposited Date: 2016-06-16 Deposition Author(s): Adam, P. , Jacek, L. , Marzenam, P.