Inorganic pyrophosphatase from mycobacterium tuberculosis in complex with inhibitor 1 and inorganic pyrophosphate
PDB DOI: 10.2210/pdb5kde/pdb
Classification: HYDROLASE/HYDROLASE INHIBITOR Organism(s): Mycobacterium Tuberculosis (Strain Atcc 25618 / H37Rv)
Deposited: 2016-06-08 Deposition Author(s): Garneau-Tsodikova, S. , Garzan, A. , Pang, A.H. , Tsodikov, O.V.
Inorganic pyrophosphatase from mycobacterium tuberculosis in complex with inhibitor 1 and inorganic pyrophosphate
Garneau-Tsodikova, S. , Garzan, A. , Pang, A.H. , Tsodikov, O.V.
Primary Citation of Related Structures: 5KDE
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Inorganic pyrophosphatase | A | 171 | Mycobacterium Tuberculosis (Strain Atcc 25618 / H37Rv) | MAHHHHHHAMQFDVTIEIPKGQRNKYEVDHETGRVRLDRYLYTPMAYPTDYGFIEDTLGDDGDPLDALVLLPQPVFPGVLVAARPVGMFRMVDEHGGDDKVLCVPAGDPRWDHVQDIGDVPAFELDAIKHFFVHYKDLEPGKFVKAADWVDRAEAEAEVQRSVERFKAGTH |
Method: X-RAY DIFFRACTION
Deposited Date: 2016-06-08 Deposition Author(s): Garneau-Tsodikova, S. , Garzan, A. , Pang, A.H. , Tsodikov, O.V.