Structure of the sh3 domain of mlk3 bound to peptide generated from phage display
PDB DOI: 10.2210/pdb5k26/pdb
Classification: TRANSFERASE Organism(s): Homo Sapiens
Deposited: 2016-05-18 Deposition Author(s): Kall, S.K. , Lavie, A.
Structure of the sh3 domain of mlk3 bound to peptide generated from phage display
Primary Citation of Related Structures: 5K26
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Mitogen-activated protein kinase kinase kinase 11,Chimera protein of MLK3-SH3 and MIP | A | 86 | Homo Sapiens | HMYANPVWTALFDYEPSGQDELALRKGDRVEVLSRDAAISGDEGWWAGQVGGQVGIFPSNYVSRGGGAIRINPNGTWSRQAETVES |
| Mitogen-activated protein kinase kinase kinase 11,Chimera protein of MLK3-SH3 and MIP | B | 86 | Homo Sapiens | HMYANPVWTALFDYEPSGQDELALRKGDRVEVLSRDAAISGDEGWWAGQVGGQVGIFPSNYVSRGGGAIRINPNGTWSRQAETVES |
Method: X-RAY DIFFRACTION
Deposited Date: 2016-05-18 Deposition Author(s): Kall, S.K. , Lavie, A.