Crystal structure of cren7-dsdna (gtgatcgc) complex
PDB DOI: 10.2210/pdb5k17/pdb
Classification: DNA BINDING PROTEIN/DNA Organism(s): Mycobacterium Avium Subsp. Hominissuis 3388 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2016-05-17 Deposition Author(s): Gong, Y. , Zhang, Z.F.
Crystal structure of cren7-dsdna (gtgatcgc) complex
Primary Citation of Related Structures: 5K17
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Chromatin protein Cren7 | A | 60 | Mycobacterium Avium Subsp. Hominissuis 3388 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MSSGKKPVKVKTPAGKEAELVPEKVWALAPKGRKGVKIGLFKDPETGKYFRHKLPDDYPI |
Chromatin protein Cren7 | B | 60 | Mycobacterium Avium Subsp. Hominissuis 3388 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MSSGKKPVKVKTPAGKEAELVPEKVWALAPKGRKGVKIGLFKDPETGKYFRHKLPDDYPI |
Method: X-RAY DIFFRACTION
Deposited Date: 2016-05-17 Deposition Author(s): Gong, Y. , Zhang, Z.F.