Crystal structure of cren7-dsdna (gtgatcgc) complex
PDB DOI: 10.2210/pdb5k17/pdb
Classification: DNA BINDING PROTEIN/DNA Organism(s): Sulfolobus Solfataricus P2 , Synthetic Construct
Deposited: 2016-05-17 Deposition Author(s): Gong, Y. , Zhang, Z.F.
Method: X-RAY DIFFRACTION Resolution: 2.1 Å
Crystal structure of cren7-dsdna (gtgatcgc) complex
Primary Citation of Related Structures: 5K17
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Chromatin protein Cren7 | A | 60 | Sulfolobus Solfataricus P2 , Synthetic Construct | MSSGKKPVKVKTPAGKEAELVPEKVWALAPKGRKGVKIGLFKDPETGKYFRHKLPDDYPI |
| Chromatin protein Cren7 | B | 60 | Sulfolobus Solfataricus P2 , Synthetic Construct | MSSGKKPVKVKTPAGKEAELVPEKVWALAPKGRKGVKIGLFKDPETGKYFRHKLPDDYPI |
Method: X-RAY DIFFRACTION
Deposited Date: 2016-05-17 Deposition Author(s): Gong, Y. , Zhang, Z.F.