Structure of the transmembrane domain of hiv-1 gp41 in bicelle
PDB DOI: 10.2210/pdb5jyn/pdb
Classification: VIRAL PROTEIN Organism(s): Human Immunodeficiency Virus 1
Deposited: 2016-05-14 Deposition Author(s): Chen, B. , Chou, J.J. , Dev, J. , Fu, Q. , Park, D.
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Envelope glycoprotein gp160 | A | 40 | Human Immunodeficiency Virus 1 | NWLWYIRIFIIIVGSLIGLRIVFAVLSLVNRVRQGYSPLS |
| Envelope glycoprotein gp160 | B | 40 | Human Immunodeficiency Virus 1 | NWLWYIRIFIIIVGSLIGLRIVFAVLSLVNRVRQGYSPLS |
| Envelope glycoprotein gp160 | C | 40 | Human Immunodeficiency Virus 1 | NWLWYIRIFIIIVGSLIGLRIVFAVLSLVNRVRQGYSPLS |
Method: SOLUTION NMR
Deposited Date: 2016-05-14 Deposition Author(s): Chen, B. , Chou, J.J. , Dev, J. , Fu, Q. , Park, D.