Solution structure of hge36: scorpine-like peptide from hadrurus gertschi
PDB DOI: 10.2210/pdb5jyh/pdb
Classification: TOXIN Organism(s): Staphylococcus Phage 2638A
Deposited: 2016-05-13 Deposition Author(s): Del Rio-Portilla, F. , Flores-Solis, D. , Rodriguez De La Vega, R.
Solution structure of hge36: scorpine-like peptide from hadrurus gertschi
Del Rio-Portilla, F. , Flores-Solis, D. , Rodriguez De La Vega, R.
Primary Citation of Related Structures: 5JYH
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Hge-scorpine | A | 44 | Staphylococcus Phage 2638A | AKNQFGCFANVDVKGDCKRHCKAEDKEGICHGTKCKCGVPISYL |
Method: SOLUTION NMR
Deposited Date: 2016-05-13 Deposition Author(s): Del Rio-Portilla, F. , Flores-Solis, D. , Rodriguez De La Vega, R.