Hiv-1 wild type protease with grl-097-13a (a adamantane p1-ligand with bis-thf in p2 and isobutylamine in p1')
PDB DOI: 10.2210/pdb5jfp/pdb
Classification: HYDROLASE/HYDROLASE inhibitor Organism(s): Human Immunodeficiency Virus 1
Deposited: 2016-04-19 Deposition Author(s): Agniswamy, J. , Wang, Y.-F. , Weber, I.T.
Hiv-1 wild type protease with grl-097-13a (a adamantane p1-ligand with bis-thf in p2 and isobutylamine in p1')
Agniswamy, J. , Wang, Y.-F. , Weber, I.T.
Primary Citation of Related Structures: 5JFP
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Protease | A | 99 | Human Immunodeficiency Virus 1 | PQITLWKRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKMIGGIGGFIKVRQYDQIIIEIAGHKAIGTVLVGPTPVNIIGRNLLTQIGATLNF |
| Protease | B | 99 | Human Immunodeficiency Virus 1 | PQITLWKRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKMIGGIGGFIKVRQYDQIIIEIAGHKAIGTVLVGPTPVNIIGRNLLTQIGATLNF |
Method: X-RAY DIFFRACTION
Deposited Date: 2016-04-19 Deposition Author(s): Agniswamy, J. , Wang, Y.-F. , Weber, I.T.