Crystal structure of the n-terminally his6-tagged hp0902, an uncharacterized protein from helicobacter pylori 26695
PDB DOI: 10.2210/pdb5j4f/pdb
Classification: UNKNOWN FUNCTION Organism(s): Helicobacter Pylori (Strain Atcc 700392 / 26695)
Deposited: 2016-04-01 Deposition Author(s): Kim, H.Y. , Kim, J.-H. , Lee, W.-C. , Sim, D.-W. , Won, H.-S.
Crystal structure of the n-terminally his6-tagged hp0902, an uncharacterized protein from helicobacter pylori 26695
Kim, H.Y. , Kim, J.-H. , Lee, W.-C. , Sim, D.-W. , Won, H.-S.
Primary Citation of Related Structures: 5J4F
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Uncharacterized protein | A | 119 | Helicobacter Pylori (Strain Atcc 700392 / 26695) | MGSSHHHHHHSSGLVPRGSHMEVVHFLEGVCFEKLHIEVLNENSSHKEIRICMPKGAVMDKHKAPGAISVQVLEGKIVFEVGDEKIEMPKGALISLEAQVLHRLDALENSVIRLSLSKK |
| Uncharacterized protein | B | 119 | Helicobacter Pylori (Strain Atcc 700392 / 26695) | MGSSHHHHHHSSGLVPRGSHMEVVHFLEGVCFEKLHIEVLNENSSHKEIRICMPKGAVMDKHKAPGAISVQVLEGKIVFEVGDEKIEMPKGALISLEAQVLHRLDALENSVIRLSLSKK |
Method: X-RAY DIFFRACTION
Deposited Date: 2016-04-01 Deposition Author(s): Kim, H.Y. , Kim, J.-H. , Lee, W.-C. , Sim, D.-W. , Won, H.-S.