Crystal structure of udp-glucose pyrophosporylase / utp-glucose-1-phosphate uridylyltransferase from burkholderia xenovorans
PDB DOI: 10.2210/pdb5j49/pdb
Classification: TRANSFERASE Organism(s): Burkholderia Xenovorans (Strain Lb400)
Deposited: 2016-03-31 Deposition Author(s): Seattle Structural Genomics Center For Infectious Disease (Ssgcid)
Crystal structure of udp-glucose pyrophosporylase / utp-glucose-1-phosphate uridylyltransferase from burkholderia xenovorans
Seattle Structural Genomics Center For Infectious Disease (Ssgcid)
Primary Citation of Related Structures: 5J49
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| UTP--glucose-1-phosphate uridylyltransferase | A | 301 | Burkholderia Xenovorans (Strain Lb400) | MAHHHHHHMLKVTKAVFPVAGLGTRFLPATKASPKEMLPIVDKPLIQYAVEEAMAAGITEMIFVTGRSKRAIEDHFDKSYEIEAELQARGKDKLLELVRSIKPSHVDCFYVRQPEALGLGHAVLCAEKLVGDNPFAVILADDLLYGTPPVMAQMIEVFDHYHSSVIGVEEIPAQETKSYGIVDGKEWEDSIIKMSGIVEKPEPNVAPSNLGVVGRYVLKPRIFEHLRALKPGAGGELQLTDAIQSLLADEQVLAYKYHGTRFDCGSKLGYLKATVEFALRHPEVAADFEEYLRTRSPVLEG |
| UTP--glucose-1-phosphate uridylyltransferase | B | 301 | Burkholderia Xenovorans (Strain Lb400) | MAHHHHHHMLKVTKAVFPVAGLGTRFLPATKASPKEMLPIVDKPLIQYAVEEAMAAGITEMIFVTGRSKRAIEDHFDKSYEIEAELQARGKDKLLELVRSIKPSHVDCFYVRQPEALGLGHAVLCAEKLVGDNPFAVILADDLLYGTPPVMAQMIEVFDHYHSSVIGVEEIPAQETKSYGIVDGKEWEDSIIKMSGIVEKPEPNVAPSNLGVVGRYVLKPRIFEHLRALKPGAGGELQLTDAIQSLLADEQVLAYKYHGTRFDCGSKLGYLKATVEFALRHPEVAADFEEYLRTRSPVLEG |
Method: X-RAY DIFFRACTION
Deposited Date: 2016-03-31 Deposition Author(s): Seattle Structural Genomics Center For Infectious Disease (Ssgcid)