5IOK
Crystal structure of taf14 yeats domain in complex with histone h3k9cr
PDB DOI: 10.2210/pdb5iok/pdb
Classification: TRANSCRIPTION Organism(s): Pseudomonas Chlororaphis Subsp. Piscium , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2016-03-08 Deposition Author(s): Andrews, F.H. , Kuateladze, T.G.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 2.22 Å
Crystal structure of taf14 yeats domain in complex with histone h3k9cr
Andrews, F.H. , Kuateladze, T.G.
Primary Citation of Related Structures: 5IOK
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Transcription initiation factor TFIID subunit 14 | A | 142 | Pseudomonas Chlororaphis Subsp. Piscium , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GPLGSMVATVKRTIRIKTQQHILPEVPPVENFPVRQWSIEIVLLDDEGKEIPATIFDKVIYHLHPTFANPNRTFTDPPFRIEEQGWGGFPLDISVFLLEKAGERKIPHDLNFLQESYEVEHVIQIPLNKPLLTEELAKSGST |
| (ACE)QTAR(KCR)ST | C | 8 | Pseudomonas Chlororaphis Subsp. Piscium , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | XQTARXST |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2016-03-08 Deposition Author(s): Andrews, F.H. , Kuateladze, T.G.