Solution structure of an1-type zinc finger domain from cuz1 (cdc48 associated ubiquitin-like/zinc-finger protein-1)
PDB DOI: 10.2210/pdb5ij4/pdb
Classification: METAL BINDING PROTEIN Organism(s): Saccharomyces Cerevisiae
Deposited: 2016-03-01 Deposition Author(s): Allan, M. , Arthanari, H. , Bhanu, M.K. , Hanna, J. , Sun, Z.-Y.J. , Wagner, G.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of an1-type zinc finger domain from cuz1 (cdc48 associated ubiquitin-like/zinc-finger protein-1)
Allan, M. , Arthanari, H. , Bhanu, M.K. , Hanna, J. , Sun, Z.-Y.J. , Wagner, G.
Primary Citation of Related Structures: 5IJ4
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
CDC48-associated ubiquitin-like/zinc finger protein 1 | A | 49 | Saccharomyces Cerevisiae | MLDVGKHCAYCRQLDFLPFHCSFCNEDFCSNHRLKEDHHCRWLLEHEEV |
Method: SOLUTION NMR
Deposited Date: 2016-03-01 Deposition Author(s): Allan, M. , Arthanari, H. , Bhanu, M.K. , Hanna, J. , Sun, Z.-Y.J. , Wagner, G.