Structure, thermodynamics, and the role of conformational dynamics in the interactions between the n-terminal sh3 domain of crkii and proline-rich motifs in cabl
PDB DOI: 10.2210/pdb5ih2/pdb
Classification: SIGNALING PROTEIN Organism(s): Mus Musculus , Synthetic Construct
Deposited: 2016-02-28 Deposition Author(s): Bhatt, V.S. , Cho, J.-H. , Krieger, I. , Sacchettini, J.C. , Zeng, D.
Structure, thermodynamics, and the role of conformational dynamics in the interactions between the n-terminal sh3 domain of crkii and proline-rich motifs in cabl
Bhatt, V.S. , Cho, J.-H. , Krieger, I. , Sacchettini, J.C. , Zeng, D.
Primary Citation of Related Structures: 5IH2
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Adapter molecule crk | A | 58 | Mus Musculus , Synthetic Construct | AEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKYR |
Adapter molecule crk | B | 58 | Mus Musculus , Synthetic Construct | AEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKYR |
Proline rich Peptide | M | 12 | Mus Musculus , Synthetic Construct | XYEKPALPRKRX |
Proline rich Peptide | N | 12 | Mus Musculus , Synthetic Construct | XYEKPALPRKRX |
Method: X-RAY DIFFRACTION
Deposited Date: 2016-02-28 Deposition Author(s): Bhatt, V.S. , Cho, J.-H. , Krieger, I. , Sacchettini, J.C. , Zeng, D.