Nmr structures show unwinding of the gcn4p coiled coil superhelix accompanying disruption of ion pairs at acidic ph
PDB DOI: 10.2210/pdb5iew/pdb
Classification: TRANSCRIPTION Organism(s): Saccharomyces Cerevisiae
Deposited: 2016-02-25 Deposition Author(s): Alexandrescu, A.T. , Brady, M.R. , Kaplan, A.R.
Nmr structures show unwinding of the gcn4p coiled coil superhelix accompanying disruption of ion pairs at acidic ph
Alexandrescu, A.T. , Brady, M.R. , Kaplan, A.R.
Primary Citation of Related Structures: 5IEW
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
General control protein GCN4 | A | 33 | Saccharomyces Cerevisiae | GSMKQLEDKVEELLSKNYHLENEVARLKKLVGE |
General control protein GCN4 | B | 33 | Saccharomyces Cerevisiae | GSMKQLEDKVEELLSKNYHLENEVARLKKLVGE |
Method: SOLUTION NMR
Deposited Date: 2016-02-25 Deposition Author(s): Alexandrescu, A.T. , Brady, M.R. , Kaplan, A.R.