Cal pdz domain with peptide and inhibitor
PDB DOI: 10.2210/pdb5ic3/pdb
Classification: PEPTIDE BINDING PROTEIN/INHIBITOR Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2016-02-22 Deposition Author(s): Madden, D.R. , Zhao, Y.
Cal pdz domain with peptide and inhibitor
Primary Citation of Related Structures: 5IC3
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Golgi-associated PDZ and coiled-coil motif-containing protein | A | 87 | Homo Sapiens , Synthetic Construct | GPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYV |
Golgi-associated PDZ and coiled-coil motif-containing protein | B | 87 | Homo Sapiens , Synthetic Construct | GPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYV |
HPV18E6 Peptide | C | 10 | Homo Sapiens , Synthetic Construct | RLQRRRETQV |
HPV18E6 Peptide | D | 10 | Homo Sapiens , Synthetic Construct | RLQRRRETQV |
Method: X-RAY DIFFRACTION
Deposited Date: 2016-02-22 Deposition Author(s): Madden, D.R. , Zhao, Y.