Complex of mlcc bound to the tandem iq motif of myoc
PDB DOI: 10.2210/pdb5ibw/pdb
Classification: MOTOR PROTEIN Organism(s): Dictyostelium Discoideum
Deposited: 2016-02-22 Deposition Author(s): Langelaan, D.N. , Smith, S.P.
Method: X-RAY DIFFRACTION Resolution: 1.9 Å
Complex of mlcc bound to the tandem iq motif of myoc
Primary Citation of Related Structures: 5IBW
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Calcium-binding EF-hand domain-containing protein | A | 77 | Dictyostelium Discoideum | GSHMNHINTKAQVIEAFKVFDRDGNGYVTVDYLRKVLNELGDMMPADEIEEMIYEADPQNSGYVQYETFVGMLFLWD |
Calcium-binding EF-hand domain-containing protein | B | 77 | Dictyostelium Discoideum | GSHMNHINTKAQVIEAFKVFDRDGNGYVTVDYLRKVLNELGDMMPADEIEEMIYEADPQNSGYVQYETFVGMLFLWD |
Myosin IC heavy chain | C | 43 | Dictyostelium Discoideum | GSRYWHDMASRIKNAYRNYKAFQFECSNRIKNAFRNYKLYRQR |
Method: X-RAY DIFFRACTION
Deposited Date: 2016-02-22 Deposition Author(s): Langelaan, D.N. , Smith, S.P.