Quantitative characterization of configurational space sampled by hiv-1 nucleocapsid using solution nmr and x-ray scattering
PDB DOI: 10.2210/pdb5i1r/pdb
Classification: VIRAL PROTEIN Organism(s): Human Immunodeficiency Virus Type 1 (Hxb2 Isolate)
Deposited: 2016-02-05 Deposition Author(s): Clore, G.M. , Deshmukh, L. , Grishaev, A. , Schwieters, C.D.
Quantitative characterization of configurational space sampled by hiv-1 nucleocapsid using solution nmr and x-ray scattering
Clore, G.M. , Deshmukh, L. , Grishaev, A. , Schwieters, C.D.
Primary Citation of Related Structures: 5I1R
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Nucleocapsid protein p7 | A | 55 | Human Immunodeficiency Virus Type 1 (Hxb2 Isolate) | MQRGNFRNQRKIVKCFNCGKEGHTARNCRAPRKKGCWKCGKEGHQMKDCTERQAN |
Method: SOLUTION NMR, SOLUTION SCATTERING
Deposited Date: 2016-02-05 Deposition Author(s): Clore, G.M. , Deshmukh, L. , Grishaev, A. , Schwieters, C.D.