Crystal structure of smakap akb domain bound ria dimerization/docking (d/d) complex at 2.0 a resolution
PDB DOI: 10.2210/pdb5hvz/pdb
Classification: TRANSFERASE Organism(s): Bos Taurus , Synthetic Construct
Deposited: 2016-01-28 Deposition Author(s): Bruystens, J. , Burgers, P.P. , Heck, A.J.R. , Taylor, S.S. , Wu, J.
Method: X-RAY DIFFRACTION Resolution: 2 Å
Crystal structure of smakap akb domain bound ria dimerization/docking (d/d) complex at 2.0 a resolution
Bruystens, J. , Burgers, P.P. , Heck, A.J.R. , Taylor, S.S. , Wu, J.
Primary Citation of Related Structures: 5HVZ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| cAMP-dependent protein kinase type I-alpha regulatory subunit | A | 50 | Bos Taurus , Synthetic Construct | SLRECELYVQKHNIQALLKDSIVQLCTARPERPMAFLREYFEKLEKEEAK |
| cAMP-dependent protein kinase type I-alpha regulatory subunit | B | 50 | Bos Taurus , Synthetic Construct | SLRECELYVQKHNIQALLKDSIVQLCTARPERPMAFLREYFEKLEKEEAK |
| Small membrane A-kinase anchor protein | C | 24 | Bos Taurus , Synthetic Construct | TVILEYAHRLSQDILCDALQQWAC |
Method: X-RAY DIFFRACTION
Deposited Date: 2016-01-28 Deposition Author(s): Bruystens, J. , Burgers, P.P. , Heck, A.J.R. , Taylor, S.S. , Wu, J.