Insulin with proline analog hyp at position b28 in the t2 state
PDB DOI: 10.2210/pdb5hpr/pdb
Classification: HORMONE Organism(s): Homo Sapiens
Deposited: 2016-01-21 Deposition Author(s): Cahn, J.K.B. , Fang, K.Y. , Lieblich, S.A. , Tirrell, D.A.
Method: X-RAY DIFFRACTION Resolution: 1.33 Å
Insulin with proline analog hyp at position b28 in the t2 state
Cahn, J.K.B. , Fang, K.Y. , Lieblich, S.A. , Tirrell, D.A.
Primary Citation of Related Structures: 5HPR
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Insulin A-Chain | A | 21 | Homo Sapiens | GIVEQCCTSICSLYQLENYCN |
Insulin B-Chain | B | 30 | Homo Sapiens | FVNQHLCGSHLVEALYLVCGERGFFYTPKT |
Method: X-RAY DIFFRACTION
Deposited Date: 2016-01-21 Deposition Author(s): Cahn, J.K.B. , Fang, K.Y. , Lieblich, S.A. , Tirrell, D.A.