Crystal structure of the first bromodomain of human brd4 bound to cpi-0610
PDB DOI: 10.2210/pdb5hls/pdb
Classification: TRANSCRIPTION Organism(s): Homo Sapiens
Deposited: 2016-01-15 Deposition Author(s): Bellon, S.F. , Jayaram, H. , Poy, F. , Setser, J.W.
Crystal structure of the first bromodomain of human brd4 bound to cpi-0610
Bellon, S.F. , Jayaram, H. , Poy, F. , Setser, J.W.
Primary Citation of Related Structures: 5HLS
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Bromodomain-containing protein 4 | A | 128 | Homo Sapiens | GSTNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKINELPTEE |
Method: X-RAY DIFFRACTION
Deposited Date: 2016-01-15 Deposition Author(s): Bellon, S.F. , Jayaram, H. , Poy, F. , Setser, J.W.