5HJC
Brd3 second bromodomain in complex with histone h3 acetylation at k18
PDB DOI: 10.2210/pdb5hjc/pdb
Classification: SIGNALING PROTEIN/PEPTIDE Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2016-01-13 Deposition Author(s): Guan, H.P. , Li, H.T. , Li, Y.Y. , Zhao, D.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 2.6 Å
Brd3 second bromodomain in complex with histone h3 acetylation at k18
Guan, H.P. , Li, H.T. , Li, Y.Y. , Zhao, D.
Primary Citation of Related Structures: 5HJC
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Bromodomain-containing protein 3 | A | 110 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | KLSEHLRYCDSILREMLSKKHAAYAWPFYKPVDAEALELHDYHDIIKHPMDLSTVKRKMDGREYPDAQGFAADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMP |
| peptide of Histone H3.1 | B | 9 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | APRKQLATK |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2016-01-13 Deposition Author(s): Guan, H.P. , Li, H.T. , Li, Y.Y. , Zhao, D.