Crystal structure of insulin receptor kinase domain in complex with cis-(r)-7-(3-(azetidin-1-ylmethyl)cyclobutyl)-5-(3-((tetrahydro-2h-pyran-2-yl)methoxy)phenyl)-7h-pyrrolo[2,3-d]pyrimidin-4-amine.
PDB DOI: 10.2210/pdb5hhw/pdb
Classification: TRANSFERASE Organism(s): Homo Sapiens
Deposited: 2016-01-11 Deposition Author(s): Izaac, A. , Scheufler, C. , Stauffer, F.
Crystal structure of insulin receptor kinase domain in complex with cis-(r)-7-(3-(azetidin-1-ylmethyl)cyclobutyl)-5-(3-((tetrahydro-2h-pyran-2-yl)methoxy)phenyl)-7h-pyrrolo[2,3-d]pyrimidin-4-amine.
Izaac, A. , Scheufler, C. , Stauffer, F.
Primary Citation of Related Structures: 5HHW
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Insulin receptor | A | 307 | Homo Sapiens | MVFPSSVYVPDEWEVSREKITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRNLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDNCPERVTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSFPEVSFFHSEENK |
Method: X-RAY DIFFRACTION
Deposited Date: 2016-01-11 Deposition Author(s): Izaac, A. , Scheufler, C. , Stauffer, F.