The third pdz domain from the synaptic protein psd-95 (h372a mutant)
PDB DOI: 10.2210/pdb5hf4/pdb
Classification: PEPTIDE BINDING PROTEIN Organism(s): Rattus Norvegicus
Deposited: 2016-01-06 Deposition Author(s): Raman, A.S. , Ranganathan, R. , White, K.I.
The third pdz domain from the synaptic protein psd-95 (h372a mutant)
Raman, A.S. , Ranganathan, R. , White, K.I.
Primary Citation of Related Structures: 5HF4
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Disks large homolog 4 | A | 119 | Rattus Norvegicus | GSPEFLGEEDIPREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASAEQAAIALKNAGQTVTIIAQYKPEEYSRFEANSRVDSSGRIVTD |
Method: X-RAY DIFFRACTION
Deposited Date: 2016-01-06 Deposition Author(s): Raman, A.S. , Ranganathan, R. , White, K.I.