Crystal structure of the n-terminus y153h bromodomain mutant of human brd2
PDB DOI: 10.2210/pdb5hel/pdb
Classification: TRANSCRIPTION Organism(s): Homo Sapiens
Deposited: 2016-01-06 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Chiaraluce, R. , Consalvi, V. , Edwards, A.M. , Knapp, S. , Lori, C. , Newman, J.A. , Pasquo, A. , Tallant, C. , Von Delft, F.
Method: X-RAY DIFFRACTION Resolution: 1.45 Å
Crystal structure of the n-terminus y153h bromodomain mutant of human brd2
Arrowsmith, C.H. , Bountra, C. , Chiaraluce, R. , Consalvi, V. , Edwards, A.M. , Knapp, S. , Lori, C. , Newman, J.A. , Pasquo, A. , Tallant, C. , Von Delft, F.
Primary Citation of Related Structures: 5HEL
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Bromodomain-containing protein 2 | A | 126 | Homo Sapiens | SMKPGRVTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDMGTIKRRLENNYYWAASECMQDFNTMFTNCHIYNKPTDDIVLMAQTLEKIFLQKVASMPQEEQELVVTIPKN |
Method: X-RAY DIFFRACTION
Deposited Date: 2016-01-06 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Chiaraluce, R. , Consalvi, V. , Edwards, A.M. , Knapp, S. , Lori, C. , Newman, J.A. , Pasquo, A. , Tallant, C. , Von Delft, F.