X-ray structure of a lectin-bound dna duplex containing an unnatural phenanthrenyl pair
PDB DOI: 10.2210/pdb5hch/pdb
Classification: SUGAR BINDING PROTEIN Organism(s): Vibrio Nigripulchritudo , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2016-01-04 Deposition Author(s): Istrate, A. , Leumann, C.J. , Marcaida Lopez, M.J. , Roethlisberger, P. , Stocker, A. , Visini, R.
Method: X-RAY DIFFRACTION Resolution: 2.9 Å
X-ray structure of a lectin-bound dna duplex containing an unnatural phenanthrenyl pair
Istrate, A. , Leumann, C.J. , Marcaida Lopez, M.J. , Roethlisberger, P. , Stocker, A. , Visini, R.
Primary Citation of Related Structures: 5HCH
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Fucose-binding lectin | A | 114 | Vibrio Nigripulchritudo , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNETAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPLG |
Method: X-RAY DIFFRACTION
Deposited Date: 2016-01-04 Deposition Author(s): Istrate, A. , Leumann, C.J. , Marcaida Lopez, M.J. , Roethlisberger, P. , Stocker, A. , Visini, R.