5H7H
Crystal structure of the bcl6 btb domain in complex with f1324(10-13)
PDB DOI: 10.2210/pdb5h7h/pdb
Classification: Transcription/Inhibitor Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2016-11-18 Deposition Author(s): Ida, K. , Lane, W. , Snell, G. , Sogabe, S.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.95 Å
Crystal structure of the bcl6 btb domain in complex with f1324(10-13)
Ida, K. , Lane, W. , Snell, G. , Sogabe, S.
Primary Citation of Related Structures: 5H7H
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| B-cell lymphoma 6 protein | A | 141 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | LDYKDDDDKENLYFQGADSCIQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTVLMACSGLFYSIFTDQLKCNLSVINLDPEINPEGFCILLDFMYTSRLNLREGNIMAVMATAMYLQMEHVVDTCRKFIKASE |
| F1324 peptide residues 10-13 | B | 5 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | XWRVP |
| F1324 peptide residues 10-13 | C | 5 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | XWRVP |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2016-11-18 Deposition Author(s): Ida, K. , Lane, W. , Snell, G. , Sogabe, S.