5H5Q
Crystal structure of human gpx4 in complex with gxpep-1
PDB DOI: 10.2210/pdb5h5q/pdb
Classification: OXIDOREDUCTASE/OXIDOREDUCTASE INHIBITOR Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2016-11-09 Deposition Author(s): Kadotani, A. , Lane, W. , Snell, G. , Sogabe, S.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.1 Å
Crystal structure of human gpx4 in complex with gxpep-1
Kadotani, A. , Lane, W. , Snell, G. , Sogabe, S.
Primary Citation of Related Structures: 5H5Q
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Phospholipid hydroperoxide glutathione peroxidase, mitochondrial | A | 169 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SASRDDWRAARSMHEFSAKDIDGHMVNLDKYRGFVSIVTNVASQCGKTEVNYTQLVDLHARYAERGLRILAFPSNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKIEVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGVVVKRYGPMEEPLVIEKDLPHYF |
| GXpep-1 | B | 15 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | XCRVDLQGWRRCRRX |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2016-11-09 Deposition Author(s): Kadotani, A. , Lane, W. , Snell, G. , Sogabe, S.