Structure of biotin carboxyl carrier protein from pyrococcus horikoshi ot3 (delta n79) a138y mutant
PDB DOI: 10.2210/pdb5gua/pdb
Classification: TRANSFERASE Organism(s): Streptomyces Thioluteus
Deposited: 2016-08-26 Deposition Author(s): Fukasawa, Y. , Kunishima, N. , Matsuura, Y. , Naitow, H. , Nakai, K. , Tomii, K. , Yamada, K.
Structure of biotin carboxyl carrier protein from pyrococcus horikoshi ot3 (delta n79) a138y mutant
Fukasawa, Y. , Kunishima, N. , Matsuura, Y. , Naitow, H. , Nakai, K. , Tomii, K. , Yamada, K.
Primary Citation of Related Structures: 5GUA
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
149aa long hypothetical methylmalonyl-CoA decarboxylase gamma chain | A | 71 | Streptomyces Thioluteus | MENVVSAPMPGKVLRVLVRVGDRVRVGQGLLVLEAMKMENEIPSPRDGVVKRILVKEGEYVDTGQPLIELG |
Method: X-RAY DIFFRACTION
Deposited Date: 2016-08-26 Deposition Author(s): Fukasawa, Y. , Kunishima, N. , Matsuura, Y. , Naitow, H. , Nakai, K. , Tomii, K. , Yamada, K.