High resolution solution nmr structure of the spider venom peptide u3- scytotoxin-sth1h
PDB DOI: 10.2210/pdb5fzw/pdb
Classification: TOXIN Organism(s): Scytodes Thoracica
Deposited: 2016-03-15 Deposition Author(s): Loening, N.M.
High resolution solution nmr structure of the spider venom peptide u3- scytotoxin-sth1h
Primary Citation of Related Structures: 5FZW
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Venom peptide U3-SYTX-Sth1h | A | 33 | Scytodes Thoracica | GLIESIACMQKGLPCMEHVDCCHGVCDSLFCLY |
Method: SOLUTION NMR
Deposited Date: 2016-03-15 Deposition Author(s): Loening, N.M.