High resolution solution nmr structure of the spider venom peptide u3- scytotoxin-sth1a
PDB DOI: 10.2210/pdb5fzv/pdb
Classification: TOXIN Organism(s): Scytodes Thoracica
Deposited: 2016-03-15 Deposition Author(s): Loening, N.M.
High resolution solution nmr structure of the spider venom peptide u3- scytotoxin-sth1a
Primary Citation of Related Structures: 5FZV
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Venom peptide U3-SYTX-Sth1a | A | 32 | Scytodes Thoracica | GLIESIACIQKGLPCMEHSDCCRGVCEALFCQ |
Method: SOLUTION NMR
Deposited Date: 2016-03-15 Deposition Author(s): Loening, N.M.