Crystal structure of the cryptosporidium muris cytosolic leucyl-trna synthetase editing domain complex with the adduct amp-an6426
PDB DOI: 10.2210/pdb5fom/pdb
Classification: LIGASE Organism(s): Cryptosporidium Muris
Deposited: 2015-11-24 Deposition Author(s): Alley, M.R.K. , Bougdour, A. , Cusack, S. , Gut, J. , Hakimi, M.A. , Liu, R.J. , Lukarska, M. , Palencia, A. , Rosenthal, P.J. , Touquet, B. , Wang, E.D.
Crystal structure of the cryptosporidium muris cytosolic leucyl-trna synthetase editing domain complex with the adduct amp-an6426
Alley, M.R.K. , Bougdour, A. , Cusack, S. , Gut, J. , Hakimi, M.A. , Liu, R.J. , Lukarska, M. , Palencia, A. , Rosenthal, P.J. , Touquet, B. , Wang, E.D.
Primary Citation of Related Structures: 5FOM
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| LEUCYL-TRNA SYNTHETASE | A | 291 | Cryptosporidium Muris | GAMGPQEYTLIKLKIHLIPEFLGSIVKGREVFVVCATLRPETMYGQTNCWILPDGEYDLVLAFDQVIPYDAKTSDGVLCKIFDKYEDTMKECNTVYICSERSAYNMAYQGIVPLIHGREQGVSDKLLPRIVSLGKVYGEQLIGTPLSAPMTPYSLIFILPMFSISMEKGTGIVTSVPSDSPDDYAALRDIKTKPLLREKYSIKDEWILDPLEIIEVPGFGFMTAELLCNQYKIQSQNDSAKLKQAKEEIYKKEFYEGILIRGKYSGMKICDAKELIRESLIKDGYALIYLE |
Method: X-RAY DIFFRACTION
Deposited Date: 2015-11-24 Deposition Author(s): Alley, M.R.K. , Bougdour, A. , Cusack, S. , Gut, J. , Hakimi, M.A. , Liu, R.J. , Lukarska, M. , Palencia, A. , Rosenthal, P.J. , Touquet, B. , Wang, E.D.