Structure of the dna-binding domain of escherichia coli methionine biosynthesis regulator metr
PDB DOI: 10.2210/pdb5fo5/pdb
Classification: TRANSCRIPTION Organism(s): Escherichia Coli K-12
Deposited: 2015-11-18 Deposition Author(s): Carr, S.B. , Phillips, S.E. , Porter, J. , Punekar, A.S. , Stauffer, G.V. , Urbanowski, M.L.
Structure of the dna-binding domain of escherichia coli methionine biosynthesis regulator metr
Carr, S.B. , Phillips, S.E. , Porter, J. , Punekar, A.S. , Stauffer, G.V. , Urbanowski, M.L.
Primary Citation of Related Structures: 5FO5
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| HTH-TYPE TRANSCRIPTIONAL REGULATOR METR | A | 92 | Escherichia Coli K-12 | MIEVKHLKTLQALRNCGSLAAAAATLHQTQSALSHQFSDLEQRLGFRLFVRKSQPLRFTPQGEILLQLANQVLPQISQALQACNEPQQTRLR |
Method: X-RAY DIFFRACTION
Deposited Date: 2015-11-18 Deposition Author(s): Carr, S.B. , Phillips, S.E. , Porter, J. , Punekar, A.S. , Stauffer, G.V. , Urbanowski, M.L.