Crystal structure of the endonuclease from the pa subunit of influenza b virus bound to the pb2 subunit nls peptide
PDB DOI: 10.2210/pdb5fml/pdb
Classification: VIRAL PROTEIN Organism(s): Influenza B Virus , Synthetic Construct
Deposited: 2015-11-06 Deposition Author(s): Cusack, S. , Gaudon, S. , Guilligay, D.
Crystal structure of the endonuclease from the pa subunit of influenza b virus bound to the pb2 subunit nls peptide
Cusack, S. , Gaudon, S. , Guilligay, D.
Primary Citation of Related Structures: 5FML
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| PB2 SUBUNIT OF INFLUENZA B POLYMERASE | A | 29 | Influenza B Virus , Synthetic Construct | KRYSALSNDISQGIKRQRMTVESMGWALS |
| PA SUBUNIT OF INFLUENZA B POLYMERASE | B | 202 | Influenza B Virus , Synthetic Construct | MGSMAMDTFITRNFQTTIIQKAKNTMAEFSEDPELQPAMLFNICVHLEVCYVISDMNFLDEEGKSYTALEGQGKEQNLRPQYEVIEGMPRTIAWMVQRSLAQEHGIETPKYLADLFDYKTKRFIEVGITKGLADDYFWKKKEKLGNSMELMIFSYNQDYSLSNESSLDEEGKGRVLSRLTELQAELSLKNLWQVLIGEEDVE |
Method: X-RAY DIFFRACTION
Deposited Date: 2015-11-06 Deposition Author(s): Cusack, S. , Gaudon, S. , Guilligay, D.