Crystal structure of bcl-2 in complex with hbx-bh3 motif
PDB DOI: 10.2210/pdb5fcg/pdb
Classification: APOPTOSIS Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2015-12-15 Deposition Author(s): Jiang, T.Y. , Liu, M.H. , Shi, Y.G. , Wu, J.P.
Crystal structure of bcl-2 in complex with hbx-bh3 motif
Jiang, T.Y. , Liu, M.H. , Shi, Y.G. , Wu, J.P.
Primary Citation of Related Structures: 5FCG
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Apoptosis regulator Bcl-2 | A | 168 | Homo Sapiens , Synthetic Construct | AHMAHAGRSGYDNREIVMKYIHYKLSQRGYEWDAGDDAEENRTEAPEGTESEVVHLALRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGCFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMR |
| Protein X | C | 26 | Homo Sapiens , Synthetic Construct | EYIKDCVFKDWEELGEEIRLKVFVLG |
Method: X-RAY DIFFRACTION
Deposited Date: 2015-12-15 Deposition Author(s): Jiang, T.Y. , Liu, M.H. , Shi, Y.G. , Wu, J.P.