5FB6
Room-temperature macromolecular crystallography using a micro-patterned silicon chip with minimal background scattering
PDB DOI: 10.2210/pdb5fb6/pdb
Classification: HORMONE Organism(s): Sus Scrofa
Deposited: 2015-12-14 Deposition Author(s): Burkhardt, A. , David, C. , Duman, R. , Meents, A. , Roedig, P. , Sanchez-Weatherby, J. , Vartiainen, I. , Wagner, A. , Warmer, M.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.901 Å
Room-temperature macromolecular crystallography using a micro-patterned silicon chip with minimal background scattering
Burkhardt, A. , David, C. , Duman, R. , Meents, A. , Roedig, P. , Sanchez-Weatherby, J. , Vartiainen, I. , Wagner, A. , Warmer, M.
Primary Citation of Related Structures: 5FB6
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Insulin Chain A | A | 21 | Sus Scrofa | GIVEQCCTSICSLYQLENYCN |
| Insulin Chain B | B | 30 | Sus Scrofa | FVNQHLCGSHLVEALYLVCGERGFFYTPKA |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2015-12-14 Deposition Author(s): Burkhardt, A. , David, C. , Duman, R. , Meents, A. , Roedig, P. , Sanchez-Weatherby, J. , Vartiainen, I. , Wagner, A. , Warmer, M.