Crystal structure of an aminoglycoside acetyltransferase meta-aac0020 from an uncultured soil metagenomic sample in complex with coenzyme a
PDB DOI: 10.2210/pdb5f48/pdb
Classification: TRANSFERASE Organism(s): Uncultured Bacterium
Deposited: 2015-12-03 Deposition Author(s): Anderson, W.F. , Center For Structural Genomics Of Infectious Diseases (Csgid) , Savchenko, A. , Skarina, T. , Stogios, P.J. , Xu, Z. , Yim, V.
Method: X-RAY DIFFRACTION Resolution: 1.95 Å
Crystal structure of an aminoglycoside acetyltransferase meta-aac0020 from an uncultured soil metagenomic sample in complex with coenzyme a
Anderson, W.F. , Center For Structural Genomics Of Infectious Diseases (Csgid) , Savchenko, A. , Skarina, T. , Stogios, P.J. , Xu, Z. , Yim, V.
Primary Citation of Related Structures: 5F48
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| aminoglycoside acetyltransferase meta-AAC0020 | A | 157 | Uncultured Bacterium | MGQNMEIDNFLKIERLAENDLPKFIQLIRLFEAVFEMKNFSIPDSEHLQKLLNQNNFYVFVALLENKIVGGLTSYVLEQYYSEKPLAYIYDLAVDTNWQRQGIGKKLITATNQFYTEKGFEEVFVQADKVDDYALDFYRSTKPTAEEQVVHFYYTLK |
| aminoglycoside acetyltransferase meta-AAC0020 | B | 157 | Uncultured Bacterium | MGQNMEIDNFLKIERLAENDLPKFIQLIRLFEAVFEMKNFSIPDSEHLQKLLNQNNFYVFVALLENKIVGGLTSYVLEQYYSEKPLAYIYDLAVDTNWQRQGIGKKLITATNQFYTEKGFEEVFVQADKVDDYALDFYRSTKPTAEEQVVHFYYTLK |
Method: X-RAY DIFFRACTION
Deposited Date: 2015-12-03 Deposition Author(s): Anderson, W.F. , Center For Structural Genomics Of Infectious Diseases (Csgid) , Savchenko, A. , Skarina, T. , Stogios, P.J. , Xu, Z. , Yim, V.