Crystal structure of the human brpf1 bromodomain in complex with seed10
PDB DOI: 10.2210/pdb5eps/pdb
Classification: DNA BINDING PROTEIN Organism(s): Homo Sapiens
Deposited: 2015-11-12 Deposition Author(s): Caflisch, A. , Zhu, J.
Method: X-RAY DIFFRACTION Resolution: 1.47 Å
Crystal structure of the human brpf1 bromodomain in complex with seed10
Primary Citation of Related Structures: 5EPS
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Peregrin | A | 116 | Homo Sapiens | SMEMQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKMG |
Method: X-RAY DIFFRACTION
Deposited Date: 2015-11-12 Deposition Author(s): Caflisch, A. , Zhu, J.