5EPJ
Crystal structure of chromodomain of cbx7 in complex with inhibitor unc3866
PDB DOI: 10.2210/pdb5epj/pdb
Classification: TRANSCRIPTION/TRANSCRIPTION INHIBITOR Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2015-11-11 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Dickson, B.M. , Edwards, A.M. , Frye, S.V. , James, L.I. , Liu, Y. , Min, J. , Structural Genomics Consortium (Sgc) , Stuckey, J.I. , Tempel, W. , Walker, J.R.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.6 Å
Crystal structure of chromodomain of cbx7 in complex with inhibitor unc3866
Arrowsmith, C.H. , Bountra, C. , Dickson, B.M. , Edwards, A.M. , Frye, S.V. , James, L.I. , Liu, Y. , Min, J. , Structural Genomics Consortium (Sgc) , Stuckey, J.I. , Tempel, W. , Walker, J.R.
Primary Citation of Related Structures: 5EPJ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Chromobox protein homolog 7 | A | 56 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEE |
| peptide-like inhibitor UNC3866 | B | 6 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | XFALXX |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2015-11-11 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Dickson, B.M. , Edwards, A.M. , Frye, S.V. , James, L.I. , Liu, Y. , Min, J. , Structural Genomics Consortium (Sgc) , Stuckey, J.I. , Tempel, W. , Walker, J.R.