Crystal structure of the second bromodomain of pleckstrin homology domain interacting protein (phip) in complex with compound-13 n11537 (sgc - diamond i04-1 fragment screening)
PDB DOI: 10.2210/pdb5eni/pdb
Classification: SIGNALING PROTEIN Organism(s): Homo Sapiens
Deposited: 2015-11-09 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Bradley, A. , Brennan, P. , Burgess-Brown, N. , Collins, P. , Cox, O. , Edwards, A. , Krojer, T. , Structural Genomics Consortium (Sgc) , Szykowska, A. , Talon, R. , Von Delft, F.
Crystal structure of the second bromodomain of pleckstrin homology domain interacting protein (phip) in complex with compound-13 n11537 (sgc - diamond i04-1 fragment screening)
Arrowsmith, C.H. , Bountra, C. , Bradley, A. , Brennan, P. , Burgess-Brown, N. , Collins, P. , Cox, O. , Edwards, A. , Krojer, T. , Structural Genomics Consortium (Sgc) , Szykowska, A. , Talon, R. , Von Delft, F.
Primary Citation of Related Structures: 5ENI
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| PH-interacting protein | A | 131 | Homo Sapiens | YFQSMSYDIQAWKKQCEELLNLIFQCEDSEPFRQPVDLLEYPDYRDIIDTPMDFATVRETLEAGNYESPMELCKDVRLIFSNSKAYTPSKRSRIYSMSLRLSAFFEEHISSVLSDYKSALRFHKRNTITKR |
Method: X-RAY DIFFRACTION
Deposited Date: 2015-11-09 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Bradley, A. , Brennan, P. , Burgess-Brown, N. , Collins, P. , Cox, O. , Edwards, A. , Krojer, T. , Structural Genomics Consortium (Sgc) , Szykowska, A. , Talon, R. , Von Delft, F.